Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MPC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-60 of human MPC2 (NP_056230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MPC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-60 of human MPC2 (NP_056230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03737A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MPC2 |
| Target Synonyms | BRP44; SLC54A2; MPC2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-60 of human MPC2 (NP_056230.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM | Uniprot ID | O95563 |
Uniprot Id
O95563
Target Species
Human
Target Name
MPC2
Target Full Name
Mitochondrial pyruvate carrier 2
Target Function
Mediates the uptake of pyruvate into mitochondria.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Target Synonyms
MPC2; BRP44; Mitochondrial pyruvate carrier 2; Brain protein 44
Target Background
Enables identical protein binding activity. Predicted to be involved in mitochondrial pyruvate transmembrane transport. Predicted to act upstream of or within mitochondrial acetyl-CoA biosynthetic process from pyruvate and positive regulation of insulin secretion involved in cellular response to glucose stimulus. Located in mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
