Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MPHOSPH6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human MPHOSPH6 (NP_005783.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MPHOSPH6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human MPHOSPH6 (NP_005783.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04845A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MPHOSPH6 |
| Target Synonyms | MPP; MPP6; MPP-6; MPHOSPH6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, HepG2, Jurkat, Mouse brain, Mouse lung, Raji, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human MPHOSPH6 (NP_005783.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD | Uniprot ID | Q99547 |
Uniprot Id
Q99547
Target Species
Human
Target Name
MPHOSPH6
Target Full Name
M-phase phosphoprotein 6
Target Function
RNA-binding protein that associates with the RNA exosome complex. Involved in the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and play a role in recruiting the RNA exosome complex to pre-rRNA; this function may include C1D.
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm. Note=Cytoplasmic in M phase.
Target Protein Families
MPP6 family
Target Synonyms
MPHOSPH6; MPP6; M-phase phosphoprotein 6
Target Background
Predicted to enable RNA binding activity. Involved in maturation of 5.8S rRNA. Located in cytosol; nucleolus; and nucleoplasm. Colocalizes with nuclear exosome (RNase complex).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
