Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-155 of human MRPL43 (NP_789762.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MRPL43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-155 of human MRPL43 (NP_789762.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07104A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL43 |
| Target Synonyms | L43mt; MRP-L43; bMRP36a; MRPL43 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, PC-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-155 of human MRPL43 (NP_789762.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQ | Uniprot ID | Q8N983 |
Uniprot Id
Q8N983
Target Species
Human
Target Name
MRPL43
Target Full Name
Large ribosomal subunit protein mL43
Target Subcellular Location
Mitochondrion.
Target Protein Families
Mitochondrion-specific ribosomal protein mL43 family
Target Tissue Specificity
High relative levels in skeletal muscle and testis. Lower levels of expression in the heart, brain, placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, ovary, small intestine, colon and leukocytes. Expression is coregulated with TWNK.
Target Synonyms
MRPL43; 39S ribosomal protein L43; mitochondrial; L43mt; MRP-L43; Mitochondrial large ribosomal subunit protein mL43; Mitochondrial ribosomal protein bMRP36a
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
