Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL52 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 24-123 of human MRPL52 (NP_848026.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPL52 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 24-123 of human MRPL52 (NP_848026.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08555A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL52 |
| Target Synonyms | mL52; 39S ribosomal protein L52; L52mt; MRP-L52; Mrpl52; RM52 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, U-251 MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 24-123 of human MRPL52 (NP_848026.1?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ | Uniprot ID | Q86TS9 |
Uniprot Id
Q86TS9
Target Species
Human
Target Name
MRPL52
Target Full Name
Large ribosomal subunit protein mL52
Target Subcellular Location
Mitochondrion.
Target Protein Families
Mitochondrion-specific ribosomal protein mL52 family
Target Synonyms
39S ribosomal protein L52; L52mt; mitochondrial; MRP-L52; Mrpl52; RM52_HUMAN
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which has no bacterial homolog. Multiple transcript variants encoding different protein isoforms were identified through sequence analysis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
