-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 95-194 of human MRPS11(NP_001308899.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MRPS11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 95-194 of human MRPS11(NP_001308899.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08324A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS11 |
| Target Synonyms | MRPS11; HCC-2; MRP-S11; S11mt; mitochondrial ribosomal protein S11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 95-194 of human MRPS11(NP_001308899.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL | Uniprot ID | P82912 |
Uniprot Id
P82912
Target Species
Human
Target Name
MRPS11
Target Full Name
Small ribosomal subunit protein uS11m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Universal ribosomal protein uS11 family
Target Synonyms
28S ribosomal protein S11; 28S ribosomal protein S11 mitochondrial; 28S ribosomal protein S11, mitochondrial precursor; Cervical cancer proto oncogene 2 protein; Cervical cancer proto-oncogene 2 protein; HCC 2; HCC-2; mitochondrial; Mitochondrial ribosomal protein S11; MRP S11; MRP-S11; MRPS11; RPMS11; RT11_HUMAN; S11mt
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification