Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS36 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-103 of human MRPS36(NP_150597.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MRPS36 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-103 of human MRPS36(NP_150597.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08331A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS36 |
| Target Synonyms | MRPS36; DC47; MRP-S36; mitochondrial ribosomal protein S36 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, A549 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 1-103 of human MRPS36(NP_150597.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE | Uniprot ID | P82909 |
Uniprot Id
P82909
Target Species
Human
Target Name
KGD4
Target Full Name
Alpha-ketoglutarate dehydrogenase component 4
Target Function
May be necessary to recruit DLD/E3 to the mitochondrial 2-oxoglutarate dehydrogenase complex (OGDC) core composed of OGDH/E1 and DLST/E2, hence stabilizes the complex.
Target Subcellular Location
Mitochondrion.
Target Synonyms
1110018B13Rik; 28S ribosomal protein S36; DC47; MGC22896; mitochondrial; MRP-S36; MRPS36; OTTHUMP00000222036; RT36_HUMAN; S36mt
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. The mitochondrial ribosome (mitoribosome) consists of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 3p, 4q, 8p, 11q, 12q, and 20p.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
