Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MT-ND4L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40 to the C-terminus of human MT-ND4L (AXQ02532.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MT-ND4L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40 to the C-terminus of human MT-ND4L (AXQ02532.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of various lysates, using MT-ND4L Rabbit pAb at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-07178A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MT-ND4L |
| Target Synonyms | MTND4L; ND4L; MT-ND4L | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat colon, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 40 to the C-terminus of human MT-ND4L (AXQ02532.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC | Uniprot ID | P03901 |
Uniprot Id
P03901
Target Species
Human
Target Name
MT-ND4L
Target Full Name
NADH-ubiquinone oxidoreductase chain 4L
Target Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Target Involvement
Leber hereditary optic neuropathy (LHON)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Complex I subunit 4L family
Target Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
