Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MT2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human MT2A (NP_005944.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MT2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human MT2A (NP_005944.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07965A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MT2A |
| Target Synonyms | MT2; MT-2; MT-II; [KD Validated] MT2A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, Mouse liver, Mouse testis, U-87MG, U2OS | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human MT2A (NP_005944.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA | Uniprot ID | P02795 |
Uniprot Id
P02795
Target Species
Human
Target Name
MT2A
Target Full Name
Metallothionein-2
Target Function
Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Target Protein Families
Metallothionein superfamily, Type 1 family
Target Synonyms
MT2A; CES1; MT2; Metallothionein-2; MT-2; Metallothionein-2A; Metallothionein-II; MT-II
Target Background
This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions, altering the intracellular concentration of heavy metals in the cell. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. The encoded protein interacts with the protein encoded by the homeobox containing 1 gene in some cell types, controlling intracellular zinc levels, affecting apoptotic and autophagy pathways. Some polymorphisms in this gene are associated with an increased risk of cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
