-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYSM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 720-821 of human MYSM1 (NP_001078956.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYSM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 720-821 of human MYSM1 (NP_001078956.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00490A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYSM1 |
| Target Synonyms | 2ADUB; BMFS4; 2A-DUB; MYSM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-431, HepG2, Jurkat, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 720-821 of human MYSM1 (NP_001078956.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SYRLPYKFEVQQMLEEPQWGLVFEKTRWIIEKYRLSHSSVPMDKIFRRDSDLTCLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEEN | Uniprot ID | Q5VVJ2 |
Uniprot Id
Q5VVJ2
Target Species
Human
Target Name
MYSM1
Target Full Name
Deubiquitinase MYSM1
Target Function
Metalloprotease with deubiquitinase activity that plays important regulator roles in hematopoietic stem cell function, blood cell production and immune response. Participates in the normal programming of B-cell responses to antigen after the maturation process. Within the cytoplasm, plays critical roles in the repression of innate immunity and autoimmunity. Removes 'Lys-63'-linked polyubiquitins from TRAF3 and TRAF6 complexes. Attenuates NOD2-mediated inflammation and tissue injury by promoting 'Lys-63'-linked deubiquitination of RIPK2 component. Suppresses the CGAS-STING1 signaling pathway by cleaving STING1 'Lys-63'-linked ubiquitin chains. In the nucleus, acts as a hematopoietic transcription regulator derepressing a range of genes essential for normal stem cell differentiation including EBF1 and PAX5 in B-cells, ID2 in NK-cell progenitor or FLT3 in dendritic cell precursors. Deubiquitinates monoubiquitinated histone H2A, a specific tag for epigenetic transcriptional repression, leading to dissociation of histone H1 from the nucleosome.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Peptidase M67A family, MYSM1 subfamily
Target Synonyms
2A-DUB; 2ADUB; Histone H2A deubiquitinase; Histone H2A deubiquitinase MYSM1; KIAA1915; Myb like SWIRM and MPN domains 1; Myb like, SWIRM and MPN domain containing protein; Myb like, SWIRM and MPN domains 1; Myb-like; Myb-like, SWIRM and MPN domains 1; MYSM 1; mysm1; MYSM1 Myb-like, SWIRM and MPN domains 1; MYSM1_HUMAN; RP4-592A1.1; SWIRM and MPN domain-containing protein 1
Target Background
Enables histone binding activity; peptidase activity; and transcription coactivator activity. Involved in several processes, including chromatin remodeling; monoubiquitinated histone H2A deubiquitination; and positive regulation of transcription by RNA polymerase II. Located in nucleolus and nucleoplasm. Part of protein-containing complex. Implicated in diabetic retinopathy.
Notification