Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAA20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 49-178 of human NAA20 (NP_057184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against NAA20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 49-178 of human NAA20 (NP_057184.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-09376A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAA20 |
| Target Synonyms | NAT3; NAT5; MRT73; NAT3P; NAT5P; dJ1002M8.1; NAA20 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, Mouse brain | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 49-178 of human NAA20 (NP_057184.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE | Uniprot ID | P61599 |
Uniprot Id
P61599
Target Species
Human
Target Name
NAA20
Target Full Name
N-alpha-acetyltransferase 20
Target Function
Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Acetyltransferase family, ARD1 subfamily
Target Synonyms
NAA20; NAT5; N-alpha-acetyltransferase 20; EC 2.3.1.254; Methionine N-acetyltransferase; N-acetyltransferase 5; N-terminal acetyltransferase B complex catalytic subunit NAA20; N-terminal acetyltransferase B complex catalytic subunit NAT5; NatB complex subunit NAT5; NatB catalytic subunit
Target Background
NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
