-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NACC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NACC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02031A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NACC1 |
| Target Synonyms | NAC1; BEND8; NAC-1; NECFM; BTBD30; BTBD14B; NACC1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQESDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDL | Uniprot ID | Q96RE7 |
Uniprot Id
Q96RE7
Target Species
Human
Target Name
NACC1
Target Full Name
Nucleus accumbens-associated protein 1
Target Function
Functions as a transcriptional repressor. Seems to function as a transcriptional corepressor in neuronal cells through recruitment of HDAC3 and HDAC4. Contributes to tumor progression, and tumor cell proliferation and survival. This may be mediated at least in part through repressing transcriptional activity of GADD45GIP1. Required for recruiting the proteasome from the nucleus to the cytoplasm and dendritic spines.
Target Involvement
Neurodevelopmental disorder with epilepsy, cataracts, feeding difficulties, and delayed brain myelination (NECFM)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Overexpressed in several types of carcinomas including ovarian serous carcinomas. Expression levels positively correlate with tumor recurrence in ovarian serous carcinomas, and intense immunoreactivity in primary ovarian tumors predicts early recurrence.
Target Synonyms
BEND8; BTB Domain Containing 14B; BTB/POZ domain-containing protein 14B; btbd14b; FLJ37383; NAC-1; NAC1; Nacc1; NACC1_HUMAN; Nucleus accumbens-associated protein 1
Target Background
This gene encodes a member of the BTB/POZ protein family. BTB/POZ proteins are involved in several cellular processes including proliferation, apoptosis and transcription regulation. The encoded protein is a transcriptional repressor that plays a role in stem cell self-renewal and pluripotency maintenance. The encoded protein also suppresses transcription of the candidate tumor suppressor Gadd45GIP1, and expression of this gene may play a role in the progression of multiple types of cancer. A pseudogene of this gene is located on the short arm of chromosome 9.
Notification