-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NCOR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NCOR1 (NP_006302.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NCOR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NCOR1 (NP_006302.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02718A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NCOR1 |
| Target Synonyms | N-CoR; TRAC1; N-CoR1; hN-CoR; PPP1R109; NCOR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NCOR1 (NP_006302.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQIL | Uniprot ID | O75376 |
Uniprot Id
O75376
Target Species
Human
Target Name
NCOR1
Target Full Name
Nuclear receptor corepressor 1
Target Function
Mediates transcriptional repression by certain nuclear receptors. Part of a complex which promotes histone deacetylation and the formation of repressive chromatin structures which may impede the access of basal transcription factors. Participates in the transcriptional repressor activity produced by BCL6. Recruited by ZBTB7A to the androgen response elements/ARE on target genes, negatively regulates androgen receptor signaling and androgen-induced cell proliferation. Mediates the NR1D1-dependent repression and circadian regulation of TSHB expression. The NCOR1-HDAC3 complex regulates the circadian expression of the core clock gene ARTNL/BMAL1 and the genes involved in lipid metabolism in the liver.
Target Subcellular Location
Nucleus.
Target Protein Families
N-CoR nuclear receptor corepressors family
Target Research Area
Cancer
Target Synonyms
hN CoR; hNCoR; KIAA1047; N CoR; N Cor/SMRT corepressor Rip13; N CoR1; N-CoR; N-CoR1; NCOR 1; NCoR; Ncor1; NCOR1_HUMAN; Nuclear receptor co repressor 1; Nuclear receptor corepressor 1; Retinoid X receptor interacting protein 13; RIP13; Rxrip13; thyroid hormone and retinoic acid receptor associated corepressor 1; TRAC 1; TRAC1
Target Background
This gene encodes a protein that mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p. This gene is located between the Charcot-Marie-Tooth and Smith-Magenis syndrome critical regions on chromosome 17. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 17 and 20.
Notification