Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NDUFB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16487A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFB4 |
| Target Synonyms | B15; CI-B15; B4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, 293T, Mouse liver, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFRPTPKNSLMG | Uniprot ID | O95168 |
Uniprot Id
O95168
Target Species
Human
Target Name
NDUFB4
Target Full Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.
Target Protein Families
Complex I NDUFB4 subunit family
Target Synonyms
NDUFB4; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4; Complex I-B15; CI-B15; NADH-ubiquinone oxidoreductase B15 subunit
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
