Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NECAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 194-263 of human NECAP2 (NP_060560.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NECAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 194-263 of human NECAP2 (NP_060560.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05704A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NECAP2 |
| Target Synonyms | NECAP2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 194-263 of human NECAP2 (NP_060560.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF | Uniprot ID | Q9NVZ3 |
Uniprot Id
Q9NVZ3
Target Species
Human
Target Name
NECAP2
Target Full Name
Adaptin ear-binding coat-associated protein 2
Target Function
Involved in endocytosis.
Target Subcellular Location
Cytoplasmic vesicle, clathrin-coated vesicle membrane. Cell membrane.
Target Protein Families
NECAP family
Target Synonyms
Adaptin ear binding coat associated protein 2; Adaptin ear-binding coat-associated protein 2; FLJ10420; NECAP endocytosis associated 2; NECAP endocytosis associated protein 2; NECAP endocytosis-associated protein 2; NECAP-2; NECAP2; NECP2_HUMAN
Target Background
This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
