-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Nesprin 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 8220-8410 of human Nesprin 1 (NP_892006.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Nesprin 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 8220-8410 of human Nesprin 1 (NP_892006.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07426A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Nesprin 1 |
| Target Synonyms | 8B; AMC3; AMCM; CPG2; ARCA1; EDMD4; KASH1; MYNE1; Nesp1; SCAR8; C6orf98; dJ45H2.2; Nesprin 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 8220-8410 of human Nesprin 1 (NP_892006.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HDLSDRELELEDSAALSDLHWHDRSADSLLSPQPSSNLSLSLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHST | Uniprot ID | Q8NF91 |
Uniprot Id
Q8NF91
Target Species
Human
Target Name
SYNE1
Target Full Name
Nesprin-1
Target Function
Multi-isomeric modular protein which forms a linking network between organelles and the actin cytoskeleton to maintain the subcellular spatial organization. As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. May be involved in nucleus-centrosome attachment and nuclear migration in neural progenitors implicating LINC complex association with SUN1/2 and probably association with cytoplasmic dynein-dynactin motor complexes; SYNE1 and SYNE2 may act redundantly. Required for centrosome migration to the apical cell surface during early ciliogenesis. May be involved in nuclear remodeling during sperm head formation in spermatogenenis; a probable SUN3:SYNE1/KASH1 LINC complex may tether spermatid nuclei to posterior cytoskeletal structures such as the manchette
Target Involvement
Spinocerebellar ataxia, autosomal recessive, 8 (SCAR8); Emery-Dreifuss muscular dystrophy 4, autosomal dominant (EDMD4)
Target Subcellular Location
Nucleus outer membrane; Single-pass type IV membrane protein; Cytoplasmic side. Nucleus. Nucleus envelope. Cytoplasm, cytoskeleton. Cytoplasm, myofibril, sarcomere. Note=The largest part of the protein is cytoplasmic, while its C-terminal part is associated with the nuclear envelope, most probably the outer nuclear membrane. In skeletal and smooth muscles, a significant amount is found in the sarcomeres. In myoblasts, relocalized from the nuclear envelope to the nucleus and cytoplasm during cell differentiation.; [Isoform GSRP-56]: Golgi apparatus.
Target Protein Families
Nesprin family
Target Tissue Specificity
Expressed in HeLa, A431, A172 and HaCaT cells (at protein level). Widely expressed. Highly expressed in skeletal and smooth muscles, heart, spleen, peripheral blood leukocytes, pancreas, cerebellum, stomach, kidney and placenta. Isoform GSRP-56 is predomi
Target Synonyms
8B; ARCA1; C6orf98; CPG2; CPG2 full length; dJ45H2.2; EDMD4; Enaptin; Myne-1; MYNE1; Myocyte nuclear envelope protein 1; Nesp1; Nesprin 1; Nesprin-1; Nuclear envelope spectrin repeat protein 1; SCAR8; Spectrin repeat containing nuclear envelope 1; Synaptic nuclear envelope protein 1; Synaptic nuclei expressed gene 1; Syne-1; SYNE1; SYNE1_HUMAN; SYNE1B
Notification