Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NFS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-457 of human NFS1 (NP_066923.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NFS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-457 of human NFS1 (NP_066923.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02897A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NFS1 |
| Target Synonyms | IscS; NIFS; COXPD52; HUSSY-08; NFS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, BxPC-3, HepG2, Mouse brain, Mouse liver, Rat liver, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-457 of human NFS1 (NP_066923.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSFAYVEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEEVDYTVEKCIQHVKRLREMSPLWEMVQDGIDLKSIKWTQH | Uniprot ID | Q9Y697 |
Uniprot Id
Q9Y697
Target Species
Human
Target Name
NFS1
Target Full Name
Cysteine desulfurase
Target Function
Catalyzes the removal of elemental sulfur from cysteine to produce alanine. It supplies the inorganic sulfur for iron-sulfur (Fe-S) clusters. May be involved in the biosynthesis of molybdenum cofactor.
Target Subcellular Location
[Isoform Mitochondrial]: Mitochondrion.; [Isoform Cytoplasmic]: Cytoplasm. Nucleus.
Target Protein Families
Class-V pyridoxal-phosphate-dependent aminotransferase family, NifS/IscS subfamily
Target Tissue Specificity
Predominantly expressed in heart and skeletal muscle. Also found in brain, liver and pancreas.
Target Synonyms
Cysteine desulfurase; Cysteine desulfurase; mitochondrial ; HUSSY 08 ; IscS; mitochondrial; NFS1; NFS1 nitrogen fixation 1; NFS1 nitrogen fixation 1 homolog (S. cerevisiae); NFS1_HUMAN; NIFS; nitrogen fixation 1 (S. cerevisiae; homolog); nitrogen fixation gene 1; nitrogen-fixing bacteria S; homolog of; nitrogen-fixing bacteria S-like protein; OTTHUMP00000030799
Target Background
Iron-sulfur clusters are required for the function of many cellular enzymes. The proteins encoded by this gene supply inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH. The encoded proteins belong to the class-V family of pyridoxal phosphate-dependent aminotransferases. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
