-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NGFRAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human NGFRAP1 (NP_996798.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NGFRAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human NGFRAP1 (NP_996798.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02583A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NGFRAP1 |
| Target Synonyms | Bex; NADE; HGR74; NGFRAP1; DXS6984E | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, MCF7, Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human NGFRAP1 (NP_996798.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP | Uniprot ID | Q00994 |
Uniprot Id
Q00994
Target Species
Human
Target Name
BEX3
Target Full Name
Protein BEX3
Target Function
May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death. May play an important role in the pathogenesis of neurogenetic diseases.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
BEX family
Target Tissue Specificity
Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver.
Target Research Area
Apoptosis
Target Synonyms
Bex; BEX3; BEX3_HUMAN; Brain expressed X linked 3 (mouse) homolog; brain expressed; X-linked 3; Brain-expressed X-linked gene 3; Brain-expressed X-linked protein 3; DXS6984E; HGR74; NADE; Nerve growth factor receptor (TNFRSF16) associated protein 1; Nerve growth factor receptor associated protein 1; Nerve growth factor receptor-associated protein 1; NGFR-associated protein 1; NGFRAP1; Ovarian granulosa cell 13.0 kDa protein HGR74; ovarian granulosa cell protein (13kD); Ovarian granulosa cell protein; p75NTR associated cell death executor; p75NTR-associated cell death executor; Protein BEX3
Target Background
Enables identical protein binding activity. Predicted to be involved in signal transduction. Predicted to act upstream of or within extrinsic apoptotic signaling pathway via death domain receptors. Located in cytosol.
Notification