-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLRP6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-110 of human NLRP6 (NP_612202.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NLRP6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-110 of human NLRP6 (NP_612202.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12808A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLRP6 |
| Target Synonyms | AVR; NAVR; PAN3; NALP6; PYPAF5; CLR11.4; NAVR/AVR; NLRP6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse large intestine, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-110 of human NLRP6 (NP_612202.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERADAVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSG | Uniprot ID | P59044 |
Uniprot Id
P59044
Target Species
Human
Target Name
NLRP6
Target Full Name
NACHT, LRR and PYD domains-containing protein 6
Target Function
As the sensor component of the NLRP6 inflammasome, plays a crucial role in innate immunity and inflammation. In response to pathogens and other damage-associated signals, initiates the formation of the inflammasome polymeric complex, made of NLRP6, PYCARD and CASP1 (and possibly CASP4 and CASP5). Recruitment of proCASP1 to the inflammasome promotes its activation and CASP1-catalyzed IL1B and IL18 maturation and secretion in the extracellular milieu. The precise NLRP6 activation stimulus has not been identified yet. Essential for gut mucosal self-renewal and proliferation. Maintains intestinal homeostasis and a healthy intestinal microbiota. This function is, at least partially, mediated by IL18, and not IL1B, produced by nonhematopoietic cells. Influences intestinal barrier function and microbial homeostasis through the regulation of goblet cell mucus secretion. Acts by promoting autophagy in goblet cells, an essential step for mucus granule exocytosis. Its role in goblet cell physiology is inflammasome-dependent, but IL1B- and IL18-independent. During systemic bacterial infections, may negatively regulate inflammatory signaling and inhibit the influx of monocytes and neutrophils to the circulation and to the peritoneum. May promote peripheral nerve recovery following injury via an inflammasome-independent mechanism.
Target Subcellular Location
Cytoplasm. Inflammasome. Cell membrane. Nucleus membrane.
Target Protein Families
NLRP family
Target Tissue Specificity
Expressed in peripheral blood leukocytes, predominantly in granulocytes and, at lower levels, in CD4(+) and CD8(+) T-cells. Expressed in colonic myofibroblasts (at protein level).
Target Research Area
Others
Target Synonyms
Angiotensin II/vasopressin receptor; AVR; CLR11.4; NACHT, leucine rich repeat and PYD containing 6; NACHT, LRR and PYD containing protein 6; NACHT, LRR and PYD domains-containing protein 6; NAVR; NAVR/AVR; NLR family, pyrin domain containing 6; Nlrp6; NLRP6_HUMAN; Nucleotide binding oligomerization domain, leucine rich repeat and pyrin domain containing 6; PAN3; PYPAF5; PYRIN containing APAF1 like protein 5; PYRIN-containing APAF1-like protein 5
Target Background
The protein encoded by this gene binds arginine-vasopressin and may be involved in the arginine-vasopressin-mediated regulation of renal salt-water balance. The encoded protein also mediates inflammatory responses in the colon to allow recovery from intestinal epithelial damage and protects against tumorigenesis and the development of colitis. Finally, this protein can increase activation of NF-kappa-B, activation of CASP1 through interaction with ASC, and cAMP accumulation. Two transcript variants encoding different isoforms have been found for this gene.
Notification