-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NMDAR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 810-910 of human NMDAR1 (NP_015566.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NMDAR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 810-910 of human NMDAR1 (NP_015566.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12863A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Nmdar1 |
| Target Synonyms | NR1; MRD8; GluN1; NMDA1; DEE101; NDHMSD; NDHMSR; NMD-R1; NMDAR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 810-910 of human NMDAR1 (NP_015566.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQ | Uniprot ID | Q05586 |
Uniprot Id
Q05586
Target Species
Human
Target Name
GRIN1
Target Full Name
Glutamate receptor ionotropic, NMDA 1
Target Function
Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+). Sensitivity to glutamate and channel kinetics depend on the subunit composition.
Target Involvement
Neurodevelopmental disorder with or without hyperkinetic movements and seizures, autosomal dominant (NDHMSD)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane. Cell junction, synapse, postsynaptic density.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, NR1/GRIN1 subfamily
Target Research Area
Neuroscience
Target Synonyms
GluN1; Glutamate [NMDA] receptor subunit zeta-1; Glutamate receptor ionotropic N methyl D aspartate 1; Glutamate receptor ionotropic, N-methyl-D aspartate, subunit 1; glutamate receptor ionotropic, NMDA 1; Grin1; MRD8; N methyl D aspartate receptor; N methyl D aspartate receptor channel subunit zeta 1; N methyl D aspartate receptor subunit NR1; N-methyl-D-aspartate receptor subunit NR1; NMD-R1; NMDA 1; NMDA R1; NMDA receptor 1; NMDA1; NMDAR; NMDZ1_HUMAN; NR1
Target Background
The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
Notification