Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NME3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-169 of human NME3 (NP_002504.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NME3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-169 of human NME3 (NP_002504.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04274A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NME3 |
| Target Synonyms | NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2; NME3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Raji, THP-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-169 of human NME3 (NP_002504.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE | Uniprot ID | Q13232 |
Uniprot Id
Q13232
Target Species
Human
Target Name
NME3
Target Full Name
Nucleoside diphosphate kinase 3
Target Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis.
Target Protein Families
NDK family
Target Synonyms
c371H6.2; DR-nm23; Expressed in non metastatic cells 3; NDK 3; NDK3; NDK3_HUMAN; NDP kinase 3; NDP kinase C; NDPK C; NDPKC; NM23 H3; nm23-H3; NM23H3; NME 3; NME/NM23 nucleoside diphosphate kinase 3; Nme3; Non metastatic cells 3 protein expressed in; Nucleoside diphosphate kinase 3; Nucleoside diphosphate kinase C
Target Background
Predicted to enable nucleoside diphosphate kinase activity. Predicted to be involved in apoptotic process and nucleotide metabolic process. Predicted to be located in cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
