-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-216 of human NOD2 (NP_071445.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NOD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-216 of human NOD2 (NP_071445.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12659A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOD2 |
| Target Synonyms | CD; ACUG; BLAU; IBD1; YAOS; BLAUS; NLRC2; NOD2B; CARD15; CLR16.3; PSORAS1; NOD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat spleen | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-216 of human NOD2 (NP_071445.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEA | Uniprot ID | Q9HC29 |
Uniprot Id
Q9HC29
Target Species
Human
Target Name
NOD2
Target Full Name
Nucleotide-binding oligomerization domain-containing protein 2
Target Function
Involved in gastrointestinal immunity. Upon stimulation by muramyl dipeptide (MDP), a fragment of bacterial peptidoglycan, binds the proximal adapter receptor-interacting RIPK2, which recruits ubiquitin ligases as XIAP, BIRC2, BIRC3, INAVA and the LUBAC complex, triggering activation of MAP kinases and activation of NF-kappa-B signaling. This in turn leads to the transcriptional activation of hundreds of genes involved in immune response. Required for MDP-induced NLRP1-dependent CASP1 activation and IL1B release in macrophages. Component of an autophagy-mediated antibacterial pathway together with ATG16L1. Plays also a role in sensing single-stranded RNA (ssRNA) from viruses. Interacts with mitochondrial antiviral signaling/MAVS, leading to activation of interferon regulatory factor-3/IRF3 and expression of type I interferon.
Target Involvement
Blau syndrome (BLAUS); Inflammatory bowel disease 1 (IBD1); Yao syndrome (YAOS)
Target Subcellular Location
Cytoplasm. Membrane. Mitochondrion. Basolateral cell membrane.
Target Tissue Specificity
Expressed in intestinal mucosa, mainly in Paneth cells and, at lower extent, in the glandular epithelium.
Target Synonyms
ACUG; Arthrocutaneouveal granulomatosis ; BLAU; CARD15; Caspase recruitment domain family, member 15; Caspase recruitment domain protein 15; Caspase recruitment domain-containing protein 15; CD; CLR16.3; IBD1; Inflammatory bowel disease protein 1; LRR containing protein; NLR family, CARD domain containing 2; NLRC2; NOD like receptor C2; NOD2; NOD2 protein; NOD2_HUMAN; NOD2B; nucleotide binding oligomerization domain 2; Nucleotide binding oligomerization domain containing 2; Nucleotide binding oligomerization domain, leucine rich repeat and CARD domain containing 2; Nucleotide-binding oligomerization domain-containing protein 2; PSORAS1
Target Background
This gene is a member of the Nod1/Apaf-1 family and encodes a protein with two caspase recruitment (CARD) domains and six leucine-rich repeats (LRRs). The protein is primarily expressed in the peripheral blood leukocytes. It plays a role in the immune response to intracellular bacterial lipopolysaccharides (LPS) by recognizing the muramyl dipeptide (MDP) derived from them and activating the NFKB protein. Mutations in this gene have been associated with Crohn disease and Blau syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification