-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NONO/p54nrb was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 372-471 of human NONO/p54nrb (Q15233) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NONO/p54nrb was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 372-471 of human NONO/p54nrb (Q15233) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16785A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NONO/p54nrb |
| Target Synonyms | P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114; NONO/p54nrb | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 372-471 of human NONO/p54nrb (Q15233). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY | Uniprot ID | Q15233 |
Uniprot Id
Q15233
Target Species
Human
Target Name
NONO
Target Full Name
Non-POU domain-containing octamer-binding protein
Target Function
DNA- and RNA binding protein, involved in several nuclear processes. Binds the conventional octamer sequence in double-stranded DNA. Also binds single-stranded DNA and RNA at a site independent of the duplex site. Involved in pre-mRNA splicing, probably as a heterodimer with SFPQ. Interacts with U5 snRNA, probably by binding to a purine-rich sequence located on the 3' side of U5 snRNA stem 1b. Together with PSPC1, required for the formation of nuclear paraspeckles. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs. The SFPQ-NONO heteromer may be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1. The SFPQ-NONO heteromer may be involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. In vitro, the complex strongly stimulates DNA end joining, binds directly to the DNA substrates and cooperates with the Ku70/G22P1-Ku80/XRCC5 (Ku) dimer to establish a functional preligation complex. NONO is involved in transcriptional regulation. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional activity. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Important for the functional organization of GABAergic synapses. Plays a specific and important role in the regulation of synaptic RNAs and GPHN/gephyrin scaffold structure, through the regulation of GABRA2 transcript. Plays a key role during neuronal differentiation by recruiting TET1 to genomic loci and thereby regulating 5-hydroxymethylcytosine levels. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
Target Involvement
Mental retardation, X-linked, syndromic, 34 (MRXS34)
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Nucleus speckle. Chromosome. Note=Detected in punctate subnuclear structures often located adjacent to splicing speckles, called paraspeckles.
Target Tissue Specificity
Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
52 kDa subunit; 54 kDa nuclear RNA and DNA binding protein ; 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; DNA binding p52/p100 complex 52 kDa subunit ; DNA-binding p52/p100 complex; NMT 55; NMT55; Non Pou domain containing octamer (ATGCAAAT) binding protein; Non POU domain containing octamer binding ; Non POU domain containing octamer binding protein; Non-POU domain-containing octamer-binding protein; Nono; NonO protein; NONO_HUMAN; NRB 54; NRB; NRB54; Nuclear RNA binding protein 54kD ; P54; p54(nrb); p54nrb; PPP1R114; Protein phosphatase 1 regulatory subunit 114
Target Background
This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
Notification