-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-151 of human NPC2 (NP_006423.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NPC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-151 of human NPC2 (NP_006423.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11840A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPC2 |
| Target Synonyms | HE1; EDDM1; NPC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-151 of human NPC2 (NP_006423.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL | Uniprot ID | P61916 |
Uniprot Id
P61916
Target Species
Human
Target Name
NPC2
Target Full Name
NPC intracellular cholesterol transporter 2
Target Function
Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the lysosomal compartment. Unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes is transferred by NPC2 to the cholesterol-binding pocket in the N-terminal domain of NPC1. May bind and mobilize cholesterol that is associated with membranes. NPC2 binds cholesterol with a 1:1 stoichiometry. Can bind a variety of sterols, including lathosterol, desmosterol and the plant sterols stigmasterol and beta-sitosterol. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport.
Target Involvement
Niemann-Pick disease C2 (NPC2)
Target Subcellular Location
Secreted. Endoplasmic reticulum. Lysosome.
Target Protein Families
NPC2 family
Target Tissue Specificity
Detected in gallbladder bile. Detected in fibroblasts, kidney, liver, spleen, small intestine, placenta and testis (at protein level). Epididymis.
Target Synonyms
EDDM1; Epididymal protein 1; Epididymal secretory protein; Epididymal secretory protein E1; hE1; Human epididymis-specific protein 1; Niemann-Pick disease type C2; Niemann-Pick disease type C2 protein; NPC intracellular cholesterol transporter 2; NPC2; NPC2_HUMAN; Tissue specific secretory protein
Target Background
This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.
Notification