Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPEPL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 374-523 of human NPEPL1 (NP_078939.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NPEPL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 374-523 of human NPEPL1 (NP_078939.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05647A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPEPL1 |
| Target Synonyms | bA261P9.2; NPEPL1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, MCF7, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 374-523 of human NPEPL1 (NP_078939.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLLNLVSPLGCEVDVEEGDLGRDSKRRRLV | Uniprot ID | Q8NDH3 |
Uniprot Id
Q8NDH3
Target Species
Human
Target Name
NPEPL1
Target Full Name
Probable aminopeptidase NPEPL1
Target Function
Probably catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.
Target Protein Families
Peptidase M17 family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
Aminopeptidase like 1 ; Aminopeptidase-like 1; bA261P9.2; KIAA1974; NPEPL 1; NPEPL1; PEPL1_HUMAN; Probable aminopeptidase NPEPL1
Target Background
Predicted to enable manganese ion binding activity and metalloaminopeptidase activity. Predicted to be involved in proteolysis. Located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
