-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 142-271 of human NUBP2 (NP_036357.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 142-271 of human NUBP2 (NP_036357.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08732A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUBP2 |
| Target Synonyms | CFD1; CIAO6; NBP 2; NUBP1; NUBP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, HepG2, LO2, Mouse brain, Mouse lung, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 142-271 of human NUBP2 (NP_036357.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCTECTSVFSRGGGEELAQLAGVPFLGSVPLDPALMRTLEEGHDFIQEFPGSPAFAALTSIAQKILDATPACLP | Uniprot ID | Q9Y5Y2 |
Uniprot Id
Q9Y5Y2
Target Species
Human
Target Name
NUBP2
Target Full Name
Cytosolic Fe-S cluster assembly factor NUBP2
Target Function
Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Negatively regulates cilium formation and structure.
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm. Cytoplasm, cytoskeleton, cilium axoneme. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, microtubule organizing center.
Target Protein Families
Mrp/NBP35 ATP-binding proteins family, NUBP2/CFD1 subfamily
Target Tissue Specificity
Widely expressed with highest expression in skeletal muscle.
Target Synonyms
C447E6.1 (nucleotide binding protein 1 (E.coli MinD like) ); CFD1; Cytosolic Fe-S cluster assembly factor NUBP2; D17Wsu11e; Homolog of yeast cytosolic FeS cluster deficient 1; NBP 2; NUBP1; Nubp2; NUBP2_HUMAN; Nucleotide binding protein 2 (E.coli MinD like); Nucleotide binding protein 2 (MinD homolog, E. coli); Nucleotide binding protein 2; Nucleotide-binding protein 2
Target Background
This gene encodes an adenosine triphosphate (ATP) and metal-binding protein that is required for the assembly of cyotosolic iron-sulfur proteins. The encoded protein functions in a heterotetramer with nucleotide-binding protein 1 (NUBP1). Alternative splicing results in multiple transcript variants.
Notification