Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUP160 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human NUP160 (NP_056046.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUP160 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human NUP160 (NP_056046.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09577A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUP160 |
| Target Synonyms | NPHS19; NUP160 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, HepG2, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human NUP160 (NP_056046.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNR | Uniprot ID | Q12769 |
Uniprot Id
Q12769
Target Species
Human
Target Name
NUP160
Target Full Name
Nuclear pore complex protein Nup160
Target Function
Functions as a component of the nuclear pore complex (NPC). Involved in poly(A)+ RNA transport.
Target Subcellular Location
Nucleus, nuclear pore complex.
Target Synonyms
160 kDa nucleoporin; DKFZp686M14102; FLJ22583; KIAA0197; MGC150678; MGC150679; NU160_HUMAN; Nuclear pore complex protein Nup160; Nucleoporin 160kD; Nucleoporin 160kDa; Nucleoporin Nup160; NUP 160; NUP120; Nup160
Target Background
A structural constituent of nuclear pore. Involved in mRNA export from nucleus and nephron development. Part of nuclear pore outer ring. Colocalizes with kinetochore. Implicated in nephrotic syndrome type 19.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
