Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUTF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human NUTF2 (NP_005787.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUTF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human NUTF2 (NP_005787.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09386A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUTF2 |
| Target Synonyms | NTF2; PP15; NTF-2; NUTF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human NUTF2 (NP_005787.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG | Uniprot ID | P61970 |
Uniprot Id
P61970
Target Species
Human
Target Name
NUTF2
Target Full Name
Nuclear transport factor 2
Target Function
Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus outer membrane. Nucleus, nuclear pore complex. Nucleus inner membrane. Nucleus, nucleoplasm.
Target Research Area
Signal Transduction
Target Synonyms
NTF 2; NTF-2; NTF2; NTF2_HUMAN; Nuclear transport factor 2; Nutf2; Placental protein 15; PP15
Target Background
This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
