Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against p47phox/NCF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 291-390 of human p47phox/NCF1 (P14598) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against p47phox/NCF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 291-390 of human p47phox/NCF1 (P14598) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13944A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | p47phox/NCF1 |
| Target Synonyms | CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A; p47phox/NCF1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 291-390 of human p47phox/NCF1 (P14598). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV | Uniprot ID | P14598 |
Uniprot Id
P14598
Target Species
Human
Target Name
NCF1
Target Full Name
Neutrophil cytosol factor 1
Target Function
NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).
Target Involvement
Granulomatous disease, chronic, cytochrome-b-positive 1, autosomal recessive (CGD1)
Target Subcellular Location
Cytoplasm, cytosol. Membrane; Peripheral membrane protein; Cytoplasmic side.
Target Tissue Specificity
Detected in peripheral blood monocytes and neutrophils (at protein level).
Target Synonyms
47 kDa autosomal chronic granulomatous disease protein; 47 kDa neutrophil oxidase factor; NADPH oxidase organizer 2; NCF 47K; NCF-1; NCF-47K; Ncf1; NCF1_HUMAN; Neutrophil cytosol factor 1; Neutrophil cytosolic factor 1; neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1); Neutrophil NADPH oxidase factor 1; Nox organizer 2; Nox organizing protein 2; Nox-organizing protein 2; NOXO2; p47 phox; p47-phox; SH3 and PX domain containing protein 1A; SH3 and PX domain-containing protein 1A; SH3PXD1A
Target Background
The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
