Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against p53 DINP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against p53 DINP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01546A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | p53 DINP1 |
| Target Synonyms | SIP; Teap; p53DINP1; TP53DINP1; TP53INP1A; TP53INP1B; p53 DINP1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITP | Uniprot ID | Q96A56 |
Uniprot Id
Q96A56
Target Species
Human
Target Name
TP53INP1
Target Full Name
Tumor protein p53-inducible nuclear protein 1
Target Function
Antiproliferative and proapoptotic protein involved in cell stress response which acts as a dual regulator of transcription and autophagy. Acts as a positive regulator of autophagy. In response to cellular stress or activation of autophagy, relocates to autophagosomes where it interacts with autophagosome-associated proteins GABARAP, GABARAPL1/L2, MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and plays a major role in p53/TP53-driven oxidative stress response. Possesses both a p53/TP53-independent intracellular reactive oxygen species (ROS) regulatory function and a p53/TP53-dependent transcription regulatory function. Positively regulates p53/TP53 and p73/TP73 and stimulates their capacity to induce apoptosis and regulate cell cycle. In response to double-strand DNA breaks, promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. Acts as a tumor suppressor by inducing cell death by an autophagy and caspase-dependent mechanism. Can reduce cell migration by regulating the expression of SPARC.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus. Nucleus, PML body. Cytoplasmic vesicle, autophagosome. Note=Shuttles between the nucleus and the cytoplasm, depending on cellular stress conditions, and re-localizes to autophagosomes on autophagy activation.
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
DKFZp434M1317; FLJ22139; p53 damage inducible nuclear protein 1; p53 dependent damage inducible nuclear protein 1; p53 inducible nuclear protein 1; p53 inducible p53DINP1; p53-dependent damage-inducible nuclear protein 1; p53DINP1; SIP; Stress induced protein; Stress-induced protein; T53I1_HUMAN; Teap; TP53 DINP1; TP53 INP1; TP53DINP1; TP53INP1; TP53INP1A; TP53INP1B; Tumor protein p53 inducible nuclear protein 1; Tumor protein p53-inducible nuclear protein 1
Target Background
Predicted to enable antioxidant activity. Involved in autophagic cell death; positive regulation of autophagy; and positive regulation of transcription, DNA-templated. Located in autophagosome; cytosol; and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
