Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PACRG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human PACRG (NP_001073847.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PACRG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human PACRG (NP_001073847.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04720A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PACRG |
| Target Synonyms | GLUP; PACRG2.1; PARK2CRG; HAK005771; PACRG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, BxPC-3, Mouse lung, Mouse testis, Raji, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PACRG (NP_001073847.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPT | Uniprot ID | Q96M98 |
Uniprot Id
Q96M98
Target Species
Human
Target Name
PACRG
Target Full Name
Parkin coregulated gene protein
Target Function
Suppresses cell death induced by accumulation of unfolded Pael receptor (Pael-R, a substrate of Parkin). Facilitates the formation of inclusions consisting of Pael-R, molecular chaperones, protein degradation molecules and itself when proteasome is inhibited. May play an important role in the formation of Lewy bodies and protection of dopaminergic neurons against Parkinson disease.
Target Tissue Specificity
Expressed in all immune tissues, spleen, lymph nodes, thymus, tonsils, leukocyte and bone marrow. Expressed also in heart, brain, skeletal muscle, kidney, lung and pancreas. Expressed in primary Schwann cells and very weakly by monocyte-derived macrophage
Target Synonyms
FLJ32724; GLUP; HAK005771; Molecular chaperone/chaperonin binding protein; Molecular chaperone/chaperonin-binding protein; PACRG; PACRG_HUMAN; PARK 2 co regulated; PARK 2 coregulated; PARK2 co regulated; PARK2 coregulated; PARK2 coregulated gene protein; PARK2CRG; Parkin co regulated gene; Parkin co regulated gene protein; Parkin coregulated gene; Parkin coregulated gene protein; RP3 495O10.2
Target Background
This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
