-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAM16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-125 of human PAM16 (NP_057153.8) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAM16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-125 of human PAM16 (NP_057153.8) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00884A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAM16 |
| Target Synonyms | TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136; PAM16 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-125 of human PAM16 (NP_057153.8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT | Uniprot ID | Q9Y3D7 |
Uniprot Id
Q9Y3D7
Target Species
Human
Target Name
PAM16
Target Full Name
Mitochondrial import inner membrane translocase subunit TIM16
Target Function
Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Target Involvement
Spondylometaphyseal dysplasia, Megarbane-Dagher-Melike type (SMDMDM)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
TIM16/PAM16 family
Target Tissue Specificity
Ubiquitously expressed.
Target Research Area
Signal Transduction
Target Synonyms
CGI-136; MAGMAS; Magmas like protein; Mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction; Mitochondria-associated granulocyte macrophage CSF-signaling molecule; Mitochondrial import inner membrane translocase subunit TIM16; PAM16; Presequence translocase-associated motor 16 homolog (S. cerevisiae); Presequence translocated-associated motor subunit PAM16; TIM16; TIM16_HUMAN; TIMM16
Target Background
This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities.
Notification