-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAPD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-590 of human PAPD5 (NP_001035374.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAPD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-590 of human PAPD5 (NP_001035374.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04765A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAPD5 |
| Target Synonyms | TUT3; PAPD5; TRF4-2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse liver, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 480-590 of human PAPD5 (NP_001035374.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVSSSSATQSSSSDVDSDAT | Uniprot ID | Q8NDF8 |
Uniprot Id
Q8NDF8
Target Species
Human
Target Name
TENT4B
Target Full Name
Terminal nucleotidyltransferase 4B
Target Function
Terminal nucleotidyltransferase that catalyzes preferentially the transfert of ATP and GTP on RNA 3' poly(A) tail creating a heterogeneous 3' poly(A) tail leading to mRNAs stabilization by protecting mRNAs from active deadenylation. Also functions as a catalytic subunit of a TRAMP-like complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism. Polyadenylation with short oligo(A) tails is required for the degradative activity of the exosome on several of its nuclear RNA substrates. Doesn't need a cofactor for polyadenylation activity (in vitro). Required for cytoplasmic polyadenylation of mRNAs involved in carbohydrate metabolism, including the glucose transporter SLC2A1/GLUT1. Plays a role in replication-dependent histone mRNA degradation, probably through terminal uridylation of mature histone mRNAs. May play a role in sister chromatid cohesion. Mediates 3' adenylation of the microRNA MIR21 followed by its 3'-to-5' trimming by the exoribonuclease PARN leading to degradation. Mediates 3' adenylation of H/ACA box snoRNAs (small nucleolar RNAs) followed by its 3'-to-5' trimming by the exoribonuclease PARN which enhances snoRNA stability and maturation
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Cytoplasm. Note=Predominantly expressed in the cytoplasm (PubMed:18172165).
Target Protein Families
DNA polymerase type-B-like family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
TENT4B; GLD4; PAPD5; TRF4-2; TUT3; Terminal nucleotidyltransferase 4B; Non-canonical poly(A) RNA polymerase PAPD5; EC 2.7.7.19; PAP-associated domain-containing protein 5; Terminal guanylyltransferase; EC 2.7.7.-; Terminal uridylyltransferase 3; TUTase 3; Topoisomerase-related function protein 4-2; TRF4-2
Notification