Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PBRM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 530-680 of human PBRM1 (Q86U86) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PBRM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 530-680 of human PBRM1 (Q86U86) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16845A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PBRM1 |
| Target Synonyms | PB1; RCC; BAF180; SMARCH1; PBRM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat brain, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 530-680 of human PBRM1 (Q86U86). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRL | Uniprot ID | Q86U86 |
Uniprot Id
Q86U86
Target Species
Human
Target Name
PBRM1
Target Full Name
Protein polybromo-1
Target Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Required for the stability of the SWI/SNF chromatin remodeling complex SWI/SNF-B (PBAF). Acts as a negative regulator of cell proliferation.
Target Involvement
Renal cell carcinoma (RCC)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Widely expressed.
Target Synonyms
BAF180; BRG1-associated factor 180; CG11375; hPB1; MGC156155; MGC156156; OTTHUMP00000202149; OTTHUMP00000202150; OTTHUMP00000202151; OTTHUMP00000202153; OTTHUMP00000202163; PB1; PB1_HUMAN; Pbrm1; polybromo 1; Polybromo-1D; Protein polybromo-1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
