-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PBXIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PBXIP1 (NP_065385.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PBXIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PBXIP1 (NP_065385.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01107A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PBXIP1 |
| Target Synonyms | HPIP; PBXIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, BT-474, LO2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PBXIP1 (NP_065385.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASCPDSDNSWVLAGSESLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGEGTLFQTESPQSGSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLEGQSPPQSLPSTPKAAWIREEGRCSSSDDDTDVDMEGLRRRRGREAGPPQPMVPLAVENQAGGEGAGGE | Uniprot ID | Q96AQ6 |
Uniprot Id
Q96AQ6
Target Species
Human
Target Name
PBXIP1
Target Full Name
Pre-B-cell leukemia transcription factor-interacting protein 1
Target Function
Regulator of pre-B-cell leukemia transcription factors (BPXs) function. Inhibits the binding of PBX1-HOX complex to DNA and blocks the transcriptional activity of E2A-PBX1. Tethers estrogen receptor-alpha (ESR1) to microtubules and allows them to influence estrogen receptors-alpha signaling.
Target Subcellular Location
Cytoplasm, cytoskeleton. Nucleus. Note=Shuttles between the nucleus and the cytosol (PubMed:12360403). Mainly localized in the cytoplasm, associated with microtubules (PubMed:10825160, PubMed:12360403). Detected in small amounts in the nucleus (PubMed:10825160).
Target Tissue Specificity
Expressed in early hematopoietic precursors.
Target Synonyms
PBXIP1; HPIPPre-B-cell leukemia transcription factor-interacting protein 1; Hematopoietic PBX-interacting protein
Target Background
The protein encoded by this gene interacts with the PBX1 homeodomain protein, inhibiting its transcriptional activation potential by preventing its binding to DNA. The encoded protein, which is primarily cytosolic but can shuttle to the nucleus, also can interact with estrogen receptors alpha and beta and promote the proliferation of breast cancer, brain tumors, and lung cancer. Several transcript variants encoding different isoforms have been found for this gene. More variants exist, but their full-length natures have yet to be determined.
Notification