-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCGF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-259 of human PCGF1 (NP_116062.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PCGF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-259 of human PCGF1 (NP_116062.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03076A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCGF1 |
| Target Synonyms | NSPC1; RNF68; RNF3A-2; 2010002K04Rik; PCGF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, MCF7, Mouse brain, Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-259 of human PCGF1 (NP_116062.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR | Uniprot ID | Q9BSM1 |
Uniprot Id
Q9BSM1
Target Species
Human
Target Name
PCGF1
Target Full Name
Polycomb group RING finger protein 1
Target Function
Component of the Polycomb group (PcG) multiprotein BCOR complex, a complex required to maintain the transcriptionally repressive state of some genes, such as BCL6 and the cyclin-dependent kinase inhibitor, CDKN1A. Transcriptional repressor that may be targeted to the DNA by BCL6; this transcription repressor activity may be related to PKC signaling pathway. Represses CDKN1A expression by binding to its promoter, and this repression is dependent on the retinoic acid response element (RARE element). Promotes cell cycle progression and enhances cell proliferation as well. May have a positive role in tumor cell growth by down-regulating CDKN1A. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Within the PRC1-like complex, regulates RNF2 ubiquitin ligase activity. Regulates the expression of DPPA4 and NANOG in the NT2 embryonic carcinoma cells.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
PCGF1; NSPC1; RNF68; Polycomb group RING finger protein 1; Nervous system Polycomb-1; NSPc1; RING finger protein 68
Target Background
PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).
Notification