Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDCD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human PDCD5 (NP_004699.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PDCD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human PDCD5 (NP_004699.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09352A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDCD5 |
| Target Synonyms | TFAR19; PDCD5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human PDCD5 (NP_004699.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY | Uniprot ID | O14737 |
Uniprot Id
O14737
Target Species
Human
Target Name
PDCD5
Target Full Name
Programmed cell death protein 5
Target Function
May function in the process of apoptosis.
Target Protein Families
PDCD5 family
Target Tissue Specificity
Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.
Target Research Area
Cell Biology
Target Synonyms
PDCD5; PDCD5_HUMAN; Programmed cell death protein 5; Protein TFAR19; TF 1 cell apoptosis related protein 19; TF-1 cell apoptosis-related protein 19; TFAR19; TFAR19 novel apoptosis-related
Target Background
This gene encodes a protein that is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. The encoded protein may be an important regulator of K(lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. Pseudogenes have been identified on chromosomes 5 and 12
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
