Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDE7B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-450 of human PDE7B (NP_061818.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDE7B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-450 of human PDE7B (NP_061818.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02190A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDE7B |
| Target Synonyms | bA472E5.1; PDE7B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 341-450 of human PDE7B (NP_061818.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQHRSRGSSGSGPDHDHAGQGTESEEQEGDSP | Uniprot ID | Q9NP56 |
Uniprot Id
Q9NP56
Target Species
Human
Target Name
PDE7B
Target Full Name
3',5'-cyclic-AMP phosphodiesterase 7B
Target Function
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain.
Target Protein Families
Cyclic nucleotide phosphodiesterase family, PDE7 subfamily
Target Tissue Specificity
Highly expressed in brain. Also expressed in heart, liver, skeletal muscle and pancreas.
Target Synonyms
PDE7B; cAMP-specific 3',5'-cyclic phosphodiesterase 7B; EC 3.1.4.53
Target Background
The 3', 5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3', 5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates and provide a mechanism to downregulate cAMP and cGMP signaling. This gene encodes a cAMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
