-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDE8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PDE8A (NP_002596.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDE8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PDE8A (NP_002596.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02228A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDE8A |
| Target Synonyms | HsT19550; PDE8A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Mouse liver, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PDE8A (NP_002596.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF | Uniprot ID | O60658 |
Uniprot Id
O60658
Target Species
Human
Target Name
PDE8A
Target Full Name
High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
Target Function
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development. Binding to RAF1 reduces RAF1 'Ser-259' inhibitory-phosphorylation and stimulates RAF1-dependent EGF-activated ERK-signaling. Protects against cell death induced by hydrogen peroxide and staurosporine.
Target Protein Families
Cyclic nucleotide phosphodiesterase family, PDE8 subfamily
Target Tissue Specificity
Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.
Target Synonyms
5''-cyclic phosphodiesterase 8A; cAMP specific cyclic nucleotide phosphodiesterase 8A ; FLJ16150; High affinity cAMP specific and IBMX insensitive 3'5' cyclic phosphodiesterase 8A ; High affinity cAMP-specific and IBMX-insensitive 3''; HsT19550; PDE 8A; PDE8A; PDE8A_HUMAN; Phosphodiesterase 8A ; Phosphodiesterase8A; Weakly similar to 3'5' cyclic nucleotide phosphodiesterase
Target Background
The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE8 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification