-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDGFA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-110 of human PDGFA (NP_002598.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against PDGFA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-110 of human PDGFA (NP_002598.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-10468A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDGFA |
| Target Synonyms | PDGF1; PDGF-A; PDGFA | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-110 of human PDGFA (NP_002598.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHATKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQV | Uniprot ID | P04085 |
Uniprot Id
P04085
Target Species
Human
Target Name
PDGFA
Target Full Name
Platelet-derived growth factor subunit A
Target Function
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB.
Target Subcellular Location
Secreted. Note=Released by platelets upon wounding.
Target Protein Families
PDGF/VEGF growth factor family
Target Synonyms
PDGF A; PDGF A chain; PDGF subunit A; PDGF-1; PDGF1; PDGFA; PDGFA_HUMAN; Platelet derived growth factor alpha chain; Platelet derived growth factor alpha isoform 2 preproprotein; Platelet derived growth factor alpha polypeptide ; Platelet-derived growth factor A chain; Platelet-derived growth factor alpha polypeptide; Platelet-derived growth factor subunit A
Target Background
This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Alternative splicing results in multiple transcript variants.
Notification