-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDGFC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 166-345 of human PDGFC (NP_057289.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDGFC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 166-345 of human PDGFC (NP_057289.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10129A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDGFC |
| Target Synonyms | SCDGF; FALLOTEIN; PDGFC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, 293T, Mouse liver, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 166-345 of human PDGFC (NP_057289.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG | Uniprot ID | Q9NRA1 |
Uniprot Id
Q9NRA1
Target Species
Human
Target Name
PDGFC
Target Full Name
Platelet-derived growth factor C
Target Function
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton formation during embryonic development, especially for normal development of the craniofacial skeleton and for normal development of the palate. Required for normal skin morphogenesis during embryonic development. Plays an important role in wound healing, where it appears to be involved in three stages: inflammation, proliferation and remodeling. Plays an important role in angiogenesis and blood vessel development. Involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain has mitogenic activity in coronary artery smooth muscle cells, suggesting a role beyond the maintenance of the latency of the PDGF domain. In the nucleus, PDGFC seems to have additional function.
Target Subcellular Location
Cytoplasm, cytosol. Secreted. Nucleus. Cytoplasmic granule. Cell membrane.
Target Protein Families
PDGF/VEGF growth factor family
Target Tissue Specificity
Expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract. Highly expressed in retinal pigment epithelia. Expressed in medulloblastoma. In the kidney, constitutive
Target Synonyms
Fallotein; hSCDGF; PDGF-C; PDGFC; PDGFC latent form; PDGFC receptor-binding form; PDGFC_HUMAN; Platelet derived growth factor C; Platelet-derived growth factor C; receptor-binding form; SCDGF; Secretory growth factor like protein; Secretory growth factor like protein fallotein; Spinal cord derived growth factor; Spinal cord-derived growth factor; VEGF E; VEGF-E
Target Background
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. Alternatively spliced transcript variants have been found for this gene.
Notification