Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDLIM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human PDLIM5 (NP_006448.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDLIM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human PDLIM5 (NP_006448.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of HeLa, using PDLIM5 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
| Cat.No | ADA-07935A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDLIM5 |
| Target Synonyms | L9; ENH; LIM; ENH1; PDLIM5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PDLIM5 (NP_006448.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ADNTKKANNSQEPSPQLASSVASTRSMPESLDSPTSGRPGVTSLTAAAAFKPVGSTGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSD | Uniprot ID | Q96HC4 |
Uniprot Id
Q96HC4
Target Species
Human
Target Name
PDLIM5
Target Full Name
PDZ and LIM domain protein 5
Target Function
May play an important role in the heart development by scaffolding PKC to the Z-disk region. May play a role in the regulation of cardiomyocyte expansion. Overexpression promotes the development of heart hypertrophy. Contributes to the regulation of dendritic spine morphogenesis in neurons. May restrain postsynaptic growth of excitatory synapses.
Target Subcellular Location
Cell junction, synapse, postsynaptic density. Cell junction, synapse, presynapse. Cell junction, synapse, postsynapse. Cytoplasm, cytosol.
Target Tissue Specificity
Heart and skeletal muscle specific. Expression is commonly increased in the brain of patients with bipolar disorder, schizophrenia, and major depression.
Target Synonyms
ENH; ENH1; Enigma homolog; Enigma like LIM domain protein; Enigma like PDZ and LIM domains protein; Enigma-like PDZ and LIM domains protein; L 9; L9; LIM; PDLI5_HUMAN; PDLIM5; PDZ and LIM domain 5 ; PDZ and LIM domain protein 5
Target Background
This gene encodes a member of a family of proteins that possess a 100-amino acid PDZ domain at the N terminus and one to three LIM domains at the C-terminus. This family member functions as a scaffold protein that tethers protein kinases to the Z-disk in striated muscles. It is thought to function in cardiomyocyte expansion and in restraining postsynaptic growth of excitatory synapses. Alternative splicing of this gene results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
