-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDZD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human PDZD3 (NP_079067.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDZD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human PDZD3 (NP_079067.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02254A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDZD3 |
| Target Synonyms | IKEPP; PDZD3; PDZK2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, HT-29, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human PDZD3 (NP_079067.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEKAADLQDTASLTLKFKFNPKLGIDNPVLSLAEDHDPYDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDVVEHEDYAVVVRRIRASSPRVLLTVLARHAHDVARAQLGEDAHLCPTLGPGVRPRLCHIVKDEGGFGFSVTHGNQGPFW | Uniprot ID | Q86UT5 |
Uniprot Id
Q86UT5
Target Species
Human
Target Name
NHERF4
Target Full Name
Na(+)/H(+) exchange regulatory cofactor NHE-RF4
Target Function
Acts as a regulatory protein that associates with GUCY2C and negatively modulates its heat-stable enterotoxin-mediated activation. Stimulates SLC9A3 activity in the presence of elevated calcium ions.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Cytoplasm.
Target Tissue Specificity
Expressed in kidney and the gastrointestinal tract. Not detected in brain, heart, skeletal muscle or cells of hematopoietic origin.
Target Synonyms
IKEPP; Intestinal and kidney enriched PDZ protein; Intestinal and kidney-enriched PDZ protein; Na(+)/H(+) exchange regulatory cofactor NHE-RF4; Na/Pi cotransporter C terminal associated protein 2; Na/Pi cotransporter C-terminal-associated protein 2; NaPi-Cap2; Natrium-phosphate cotransporter IIa C-terminal-associated protein 2; NHERF-4; NHERF4; NHRF4_HUMAN; PDZ domain containing 2; PDZ domain containing 3; PDZ domain containing protein 2; PDZ domain-containing protein 2; PDZ domain-containing protein 3; PDZD 3; Pdzd3; PDZK2; Protein DLNB27; Sodium-hydrogen exchanger regulatory factor 4
Target Background
Guanylyl cyclase C (GCC, or GUCY2C; MIM 601330) produces cGMP following the binding of either endogenous ligands or heat-stable enterotoxins secreted by E. coli and other enteric bacteria. Activation of GCC initiates a signaling cascade that leads to phosphorylation of the cystic fibrosis transmembrane conductance regulator (CFTR; MIM 602421), followed by a net efflux of ions and water into the intestinal lumen. IKEPP is a regulatory protein that associates with GCC and regulates the amount of cGMP produced following receptor stimulation (Scott et al., 2002 [PubMed 11950846]).
Notification