-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PEF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEF1 (Q9UBV8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PEF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEF1 (Q9UBV8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13398A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PEF1 |
| Target Synonyms | ABP32; PEF1A; PEF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, Mouse liver, Rat pancreas | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEF1 (Q9UBV8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSS | Uniprot ID | Q9UBV8 |
Uniprot Id
Q9UBV8
Target Species
Human
Target Name
PEF1
Target Full Name
Peflin
Target Function
Calcium-binding protein that acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium. Together with PDCD6, acts as calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in endoplasmic reticulum (ER)-Golgi transport by regulating the size of COPII coats. In response to cytosolic calcium increase, the heterodimer formed with PDCD6 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification. Its role in the heterodimer formed with PDCD6 is however unclear: some evidence shows that PEF1 and PDCD6 work together and promote association between PDCD6 and SEC31 in presence of calcium. Other reports show that PEF1 dissociates from PDCD6 in presence of calcium, and may act as a negative regulator of PDCD6. Also acts as a negative regulator of ER-Golgi transport; possibly by inhibiting interaction between PDCD6 and SEC31.
Target Subcellular Location
Cytoplasm. Endoplasmic reticulum. Membrane; Peripheral membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Peripheral membrane protein.
Target Synonyms
ABP32; PEF; PEF protein with a long N terminal hydrophobic domain; PEF protein with a long N-terminal hydrophobic domain; pef1; PEF1_HUMAN; PEF1A; Peflin; Penta EF hand domain containing protein 1; Penta-EF hand domain-containing protein 1
Target Background
This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. The encoded protein has been shown to form a heterodimer with the programmed cell death 6 gene product and may modulate its function in Ca(2+) signaling. Alternative splicing results in multiple transcript variants and a pseudogene has been identified on chromosome 1.
Notification