Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PEX11B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEX11B (O96011) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PEX11B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEX11B (O96011) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13530A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PEX11B |
| Target Synonyms | PEX14B; PEX11beta; PEX11-BETA; PEX11B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | THP-1, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEX11B (O96011). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SHLSLGRKLLRLGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQES | Uniprot ID | O96011 |
Uniprot Id
O96011
Target Species
Human
Target Name
PEX11B
Target Full Name
Peroxisomal membrane protein 11B
Target Function
Involved in peroxisomal proliferation. May regulate peroxisome division by recruiting the dynamin-related GTPase DNM1L to the peroxisomal membrane. Promotes membrane protrusion and elongation on the peroxisomal surface.
Target Involvement
Peroxisome biogenesis disorder 14B (PBD14B)
Target Subcellular Location
Peroxisome membrane; Single-pass membrane protein.
Target Protein Families
Peroxin-11 family
Target Synonyms
PEX11B; Peroxisomal membrane protein 11B; Peroxin-11B; Peroxisomal biogenesis factor 11B; Protein PEX11 homolog beta; PEX11-beta
Target Background
The protein encoded by this gene facilitates peroxisomal proliferation and interacts with PEX19. The encoded protein is found in the peroxisomal membrane. Several transcript variants, some protein-coding and some not protein-coding, have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
