Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 63-180 of human PGA3 (NP_001073275.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PGA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 63-180 of human PGA3 (NP_001073275.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01633A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGA3 |
| Target Synonyms | PGA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, Mouse brain, SGC-7901, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 63-180 of human PGA3 (NP_001073275.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFD | Uniprot ID | P0DJD8 |
Uniprot Id
P0DJD8
Target Species
Human
Target Name
PGA3
Target Full Name
Pepsin A-3
Target Function
Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase A1 family
Target Synonyms
PGA3
Target Background
This gene encodes a protein precursor of the digestive enzyme pepsin, a member of the peptidase A1 family of endopeptidases. The encoded precursor is secreted by gastric chief cells and undergoes autocatalytic cleavage in acidic conditions to form the active enzyme, which functions in the digestion of dietary proteins. This gene is found in a cluster of related genes on chromosome 11, each of which encodes one of multiple pepsinogens. Pepsinogen levels in serum may serve as a biomarker for atrophic gastritis and gastric cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
