Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGAM1 (P18669) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PGAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGAM1 (P18669) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16586A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGAM1 |
| Target Synonyms | PGAMA; PGAM-B; HEL-S-35; PGAM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, HepG2, Mouse brain, Mouse liver, Rat kidney, Rat spleen, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGAM1 (P18669). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNK | Uniprot ID | P18669 |
Uniprot Id
P18669
Target Species
Human
Target Name
PGAM1
Target Full Name
Phosphoglycerate mutase 1
Target Function
Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase), but with a reduced activity.
Target Protein Families
Phosphoglycerate mutase family, BPG-dependent PGAM subfamily
Target Tissue Specificity
Expressed in the liver and brain. Not found in the muscle.
Target Synonyms
BPG dependent PGAM 1; BPG dependent PGAM1; BPG-dependent PGAM 1; OTTHUMP00000059414; PGAM 1; PGAM A; PGAM B; PGAM-B; PGAM1; PGAM1_HUMAN; PGAMA; PGAMB; Phosphoglycerate mutase 1; Phosphoglycerate mutase 1 brain; Phosphoglycerate mutase A; Phosphoglycerate mutase A nonmuscle form; Phosphoglycerate mutase isozyme B
Target Background
The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
