Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGLYRP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human PGLYRP2 (NP_443122.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PGLYRP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human PGLYRP2 (NP_443122.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07113A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGLYRP2 |
| Target Synonyms | tagL; PGRPL; PGRP-L; PGLYRPL; HMFT0141; TAGL-like; tagl-beta; tagL-alpha; PGLYRP2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PGLYRP2 (NP_443122.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLL | Uniprot ID | Q96PD5 |
Uniprot Id
Q96PD5
Target Species
Human
Target Name
PGLYRP2
Target Full Name
N-acetylmuramoyl-L-alanine amidase
Target Function
May play a scavenger role by digesting biologically active peptidoglycan (PGN) into biologically inactive fragments. Has no direct bacteriolytic activity.
Target Subcellular Location
Secreted. Membrane.
Target Protein Families
N-acetylmuramoyl-L-alanine amidase 2 family
Target Tissue Specificity
Strongly expressed in liver and fetal liver, and secreted into serum. Expressed to a much lesser extent in transverse colon, lymph nodes, heart, thymus, pancreas, descending colon, stomach and testis. Isoform 2 is not detected in the liver or serum.
Target Research Area
Immunology
Target Synonyms
PGLYRP2; PGLYRPL; PGRPL; UNQ3103/PRO10102; N-acetylmuramoyl-L-alanine amidase; EC 3.5.1.28; Peptidoglycan recognition protein 2; Peptidoglycan recognition protein long; PGRP-L
Target Background
This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
