-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHOX2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PHOX2B (NP_003915.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PHOX2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PHOX2B (NP_003915.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00947A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHOX2B |
| Target Synonyms | CCHS; PMX2B; NBLST2; NBPhox; PHOX2B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-12, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PHOX2B (NP_003915.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHG | Uniprot ID | Q99453 |
Uniprot Id
Q99453
Target Species
Human
Target Name
PHOX2B
Target Full Name
Paired mesoderm homeobox protein 2B
Target Function
Involved in the development of several major noradrenergic neuron populations, including the locus coeruleus. Transcription factor which could determine a neurotransmitter phenotype in vertebrates. Enhances second-messenger-mediated activation of the dopamine beta-hydrolase and c-fos promoters, and of several enhancers including cAMP-response element and serum-response element.
Target Involvement
Congenital central hypoventilation syndrome (CCHS); Neuroblastoma 2 (NBLST2)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family
Target Tissue Specificity
Expressed in neuroblastoma, brain and adrenal gland.
Target Synonyms
NBLST2; NBPhox; Neuroblastoma paired type homeobox protein; Neuroblastoma Phox; Paired like homeobox 2b; Paired mesoderm homeobox 2b; Paired mesoderm homeobox protein 2B; Paired-like homeobox 2B; PHOX 2B; PHOX 2B homeodomain protein; PHOX2B; PHOX2B homeodomain protein; PHX2B_HUMAN; PMX 2B ; PMX2B
Target Background
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription factor involved in the development of several major noradrenergic neuron populations and the determination of neurotransmitter phenotype. The gene product is linked to enhancement of second messenger-mediated activation of the dopamine beta-hydroylase, c-fos promoters and several enhancers, including cyclic amp-response element and serum-response element. Expansion of a 20 amino acid polyalanine tract in this protein by 5-13 aa has been associated with congenital central hypoventilation syndrome.
Notification