-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIBF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 598-757 of human PIBF1 (NP_006337.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PIBF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 598-757 of human PIBF1 (NP_006337.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02136A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIBF1 |
| Target Synonyms | PIBF; CEP90; JBTS33; C13orf24; PIBF1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 598-757 of human PIBF1 (NP_006337.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LEHRKDQVTQLSQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQLEKDVSNLNKEKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKMKT | Uniprot ID | Q8WXW3 |
Uniprot Id
Q8WXW3
Target Species
Human
Target Name
PIBF1
Target Full Name
Progesterone-induced-blocking factor 1
Target Function
Plays a role in ciliogenesis.; Pericentriolar protein required to maintain mitotic spindle pole integrity. Required for the centrosomal accumulation of PCM1 and the recruitment of centriolar satellite proteins such as BBS4. Via association with PCM1 may be involved in primary cilia formation. Required for CEP63 centrosomal localization and its interaction with WDR62. Together with CEP63 promotes centriole duplication. Promotes the centrosomal localization of CDK2.; The secreted form is a mediator of progesterone that by acting on the phospholipase A2 enzyme interferes with arachidonic acid metabolism, induces a Th2 biased immune response, and by controlling decidual naturakl killer cells (NK) activity exerts an anti-abortive effect. Increases the production of Th2-type cytokines by signaling via the JAK/STAT pathway. Activates STAT6 and inhibits STAT4 phosphorylation. Signaling via a not identified receptor seems to implicate IL4R and a GPI-anchored protein.
Target Involvement
May be associated with microcephaly.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm. Secreted.; [Isoform 1]: Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Secreted.; [Isoform 4]: Secreted.
Target Tissue Specificity
Expressed at highest levels in testis. Moderate expression is detected in spleen, thymus, prostate, ovary, small intestine, and colon. Expressed in the first trimester pregnancy decidua. Localized to extravillous cytotrophoblast (at protein level). Also f
Target Research Area
Cell Biology
Target Synonyms
PIBF1; C13orf24; PIBF; Progesterone-induced-blocking factor 1; Centrosomal protein of 90 kDa; CEP90
Target Background
This gene encodes a protein that is induced by the steroid hormone progesterone and plays a role in the maintenance of pregnancy. The encoded protein regulates multiple facets of the immune system to promote normal pregnancy including cytokine synthesis, natural killer (NK) cell activity, and arachidonic acid metabolism. Low serum levels of this protein have been associated with spontaneous pre-term labor in humans. This protein may promote the proliferation, migration and invasion of glioma.
Notification