Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIK3R3/p55PIK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-388 of human PIK3R3/p55PIK (NP_003620.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PIK3R3/p55PIK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-388 of human PIK3R3/p55PIK (NP_003620.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11453A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIK3R3/p55PIK |
| Target Synonyms | p55; p55PIK; p55-GAMMA; PIK3R3/p55PIK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-388 of human PIK3R3/p55PIK (NP_003620.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKK | Uniprot ID | Q92569 |
Uniprot Id
Q92569
Target Species
Human
Target Name
PIK3R3
Target Full Name
Phosphatidylinositol 3-kinase regulatory subunit gamma
Target Function
Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.
Target Protein Families
PI3K p85 subunit family
Target Tissue Specificity
Highest levels in brain and testis. Lower levels in adipose tissue, kidney, heart, lung and skeletal muscle.
Target Synonyms
DKFZp686P05226; FLJ41892; OTTHUMP00000009783; OTTHUMP00000009786; p55; p55 gamma; P55G_HUMAN; p55PIK; Phosphatidylinositol 3 kinase regulatory subunit gamma; Phosphatidylinositol 3 kinase regulatory subunit polypeptide 3; Phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 3 (p55, gamma); Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma; Phosphatidylinositol 3-kinase regulatory subunit gamma; Phosphoinositide 3 kinase regulatory subunit 3 (gamma); Phosphoinositide 3 kinase regulatory subunit 3; Phosphoinositide 3 kinase regulatory subunit polypeptide 3; Phosphoinositide 3 kinase, regulatory subunit 3 (p55, gamma); Phosphoinositide 3 kinase, regulatory subunit, polypeptide 3 (p55, gamma); PI3 kinase p85 subunit gamma; PI3-kinase regulatory subunit gamma; PI3-kinase subunit p55-gamma; PI3K regulatory subunit gamma; Pik3r3; PtdIns 3 kinase p85 gamma; PtdIns-3-kinase regulatory subunit gamma; PtdIns-3-kinase regulatory subunit p55-gamma
Target Background
Phosphatidylinositol 3-kinase (PI3K) phosphorylates phosphatidylinositol and similar compounds, which then serve as second messengers in growth signaling pathways. PI3K is composed of a catalytic and a regulatory subunit. The protein encoded by this gene represents a regulatory subunit of PI3K. The encoded protein contains two SH2 domains through which it binds activated protein tyrosine kinases to regulate their activity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
